Loading...
Statistics
Advertisement

Mccookco.org

Mccookco.org is hosted in United States . Mccookco.org doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Number of used plugins, modules: 0. Its server type is: Apache.

Technologies in use by Mccookco.org

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Mccookco.org

Missing HTTPS protocol.

    Meta - Mccookco.org

    Number of occurences: 2
    • Name: robots
      Content: noarchive
    • Name: googlebot
      Content: nosnippet

    Server / Hosting

    • IP: 208.91.197.27
    • Latitude: 38.00
    • Longitude: -97.00
    • Country: United States

    Rname

    • ns91.worldnic.com
    • ns92.worldnic.com
    • p.webcom.ctmail.com

    Target

    • namehost.WORLDNIC.COM

    HTTP Header Response

    HTTP/1.1 200 OK Date: Wed, 27 Jul 2016 20:15:16 GMT Server: Apache Set-Cookie: vsid=931vr2171961161931526; expires=Mon, 26-Jul-2021 20:15:16 GMT; path=/; domain=www.mccookco.org; httponly Vary: Accept-Encoding,User-Agent Content-Length: 272 Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_sr109 X-Cache-Lookup: MISS from s_sr109:80 Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive

    DNS

    host: mccookco.org
    1. class: IN
    2. ttl: 7200
    3. type: A
    4. ip: 208.91.197.27
    host: mccookco.org
    1. class: IN
    2. ttl: 7200
    3. type: NS
    4. target: ns91.worldnic.com
    host: mccookco.org
    1. class: IN
    2. ttl: 7200
    3. type: NS
    4. target: ns92.worldnic.com
    host: mccookco.org
    1. class: IN
    2. ttl: 7200
    3. type: SOA
    4. mname: NS91.WORLDNIC.COM
    5. rname: namehost.WORLDNIC.COM
    6. serial: 108082319
    7. refresh: 10800
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 3600
    host: mccookco.org
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: p.webcom.ctmail.com

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ccookco.org, www.mpccookco.org, www.pccookco.org, www.moccookco.org, www.occookco.org, www.miccookco.org, www.iccookco.org, www.mkccookco.org, www.kccookco.org, www.m.ccookco.org, www..ccookco.org, www.muccookco.org, www.uccookco.org, www.mjccookco.org, www.jccookco.org, www.mnccookco.org, www.nccookco.org, www.m-ccookco.org, www.-ccookco.org, www.mcookco.org, www.mcdcookco.org, www.mdcookco.org, www.mcrcookco.org, www.mrcookco.org, www.mctcookco.org, www.mtcookco.org, www.mcvcookco.org, www.mvcookco.org, www.mcfcookco.org, www.mfcookco.org, www.mcgcookco.org, www.mgcookco.org, www.mchcookco.org, www.mhcookco.org, www.mcncookco.org, www.mncookco.org, www.mcmcookco.org, www.mmcookco.org, www.mcjcookco.org, www.mjcookco.org, www.mcookco.org, www.mccdookco.org, www.mcdookco.org, www.mccrookco.org, www.mcrookco.org, www.mcctookco.org, www.mctookco.org, www.mccvookco.org, www.mcvookco.org, www.mccfookco.org, www.mcfookco.org, www.mccgookco.org, www.mcgookco.org, www.mcchookco.org, www.mchookco.org, www.mccnookco.org, www.mcnookco.org, www.mccmookco.org, www.mcmookco.org, www.mccjookco.org, www.mcjookco.org, www.mccokco.org, www.mccobokco.org, www.mccbokco.org, www.mccohokco.org, www.mcchokco.org, www.mccogokco.org, www.mccgokco.org, www.mccojokco.org, www.mccjokco.org, www.mccomokco.org, www.mccmokco.org, www.mcco okco.org, www.mcc okco.org, www.mccovokco.org, www.mccvokco.org, www.mccokco.org, www.mccoobkco.org, www.mccobkco.org, www.mccoohkco.org, www.mccohkco.org, www.mccoogkco.org, www.mccogkco.org, www.mccoojkco.org, www.mccojkco.org, www.mccoomkco.org, www.mccomkco.org, www.mccoo kco.org, www.mcco kco.org, www.mccoovkco.org, www.mccovkco.org, www.mccooco.org, www.mccooktco.org, www.mccootco.org, www.mccookco.org, www.mccooco.org, www.mccookgco.org, www.mccoogco.org, www.mccookbco.org, www.mccoobco.org, www.mccooknco.org, www.mccoonco.org, www.mccookhco.org, www.mccoohco.org, www.mccookyco.org, www.mccooyco.org, www.mccooklco.org, www.mccoolco.org, www.mccookoco.org, www.mccoooco.org, www.mccookuco.org, www.mccoouco.org, www.mccookico.org, www.mccooico.org, www.mccookmco.org, www.mccoomco.org, www.mccooko.org, www.mccookcdo.org, www.mccookdo.org, www.mccookcro.org, www.mccookro.org, www.mccookcto.org, www.mccookto.org, www.mccookcvo.org, www.mccookvo.org, www.mccookcfo.org, www.mccookfo.org, www.mccookcgo.org, www.mccookgo.org, www.mccookcho.org, www.mccookho.org, www.mccookcno.org, www.mccookno.org, www.mccookcmo.org, www.mccookmo.org, www.mccookcjo.org, www.mccookjo.org, www.mccookc.org, www.mccookcob.org, www.mccookcb.org, www.mccookcoh.org, www.mccookch.org, www.mccookcog.org, www.mccookcg.org, www.mccookcoj.org, www.mccookcj.org, www.mccookcom.org, www.mccookcm.org, www.mccookco .org, www.mccookc .org, www.mccookcov.org, www.mccookcv.org,

    Other Reviews

    1. Home
      Scottsdale (United States) - 72.167.191.69
      Server software: DPS/1.0.6
      Technology: BootstrapCDN, Maxcdn, CSS, Font Awesome, Html, Html5, Javascript
      Number of Javascript: 1
      Number of meta tags: 2
    2. Botel MATYLDA - Botel Matylda
      Botel MATYLDA
      Prague (Czech Republic) - 94.142.233.164
      Server software: Apache/2.2
      Technology: CSS, Html, Javascript, Php, Swf Object
      Number of Javascript: 3
      Number of meta tags: 3
    3. fukuoka school, special education school
      The mission of our organization is to educate and train the special children in such a way that their dependence on their parents be reduced and they become....
      Houston (United States) - 192.185.122.147
      G Analytics ID: UA-73672830-1
      Server software: nginx/1.10.1
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Shortcodes, Google Analytics, Wordpress
      Number of Javascript: 7
      Number of meta tags: 5
    4. superawesomemegagiganticprettysweetfriendzine.com
      Switzerland - 141.8.224.93
      Server software: Apache
      Technology: Html
    5. Circus in Education | School Workshops & Performances
      Circus in Education delivers physical demonstration and emotional skills into classrooms through school workshops & performances throughout Australia.
      Sydney (Australia) - 52.64.177.7
      Server software: Apache
      Technology: Carousel, CSS, Google Font API, Html, Html5, Iframe, Javascript, Php, Pingback, Shortcodes, Google Analytics, Wordpress
      Number of Javascript: 6
      Number of meta tags: 9
    6. srmg.info
      Lansing (United States) - 69.16.192.64
      Server software: nginx/1.10.1
      Technology: CSS, Html, Javascript, Php, Google Analytics
      Number of meta tags: 1
    7. ideenfix.de
      Germany - 62.116.130.8
      Server software: Apache
      Technology: Html, Html5
    8. beachbudcaddy.net
      Scottsdale (United States) - 184.168.221.49
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    9. Tere tulemast ! - Arvutiteenused ja kaugabi.
      Estonia - 212.47.208.172
      Server software: Apache/2
      Technology: BootstrapCDN, Maxcdn, CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery Cookie, jQuery Cycle, Lightbox, Php, Pingback, Swf Object, Google Analytics, Wordpress, Facebook Box
      Number of Javascript: 27
      Number of meta tags: 3
    10. .: Green Energy Group :.
      Romania - 86.106.30.142
      Server software: LiteSpeed
      Technology: CSS, Html
      Number of meta tags: 1